SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012041 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012041
Domain Number 1 Region: 43-238
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 4.32e-77
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000107
Further Details:      
 
Domain Number 2 Region: 319-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 7.85e-66
Family C-terminal domain of adenylylcyclase associated protein 0.0000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012041   Gene: ENSMMUG00000009188   Transcript: ENSMMUT00000012844
Sequence length 475
Comment pep:known chromosome:MMUL_1:1:42927817:42940768:1 gene:ENSMMUG00000009188 transcript:ENSMMUT00000012844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYGDSPSKAGAAPYVQAFDSLLAGPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPADNKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPP
PVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
SAPKPQTSPSPKPATKKEPAVLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences A0A096N1K2 A0A0D9S7N5 A0A2K5W2A6 A0A2K6CU40 A0A2K6QEA2 I0FIM4
ENSMMUP00000012041 XP_005543903.1.63531 XP_005543904.1.63531 XP_005543905.1.63531 XP_005543906.1.63531 XP_005543907.1.63531 XP_007977473.1.81039 XP_007977474.1.81039 XP_007977475.1.81039 XP_007977476.1.81039 XP_007977477.1.81039 XP_007977478.1.81039 XP_010352508.1.97406 XP_010352509.1.97406 XP_010352510.1.97406 XP_010352513.1.97406 XP_010352514.1.97406 XP_011761931.1.29376 XP_011761932.1.29376 XP_011761933.1.29376 XP_011761934.1.29376 XP_011761935.1.29376 XP_011761936.1.29376 XP_014991529.1.72884 XP_014991538.1.72884 XP_014991541.1.72884 XP_014991545.1.72884 XP_014991550.1.72884 XP_014991554.1.72884 XP_015293324.1.63531 XP_017728818.1.44346 XP_017728819.1.44346 XP_017728820.1.44346 XP_017728821.1.44346 XP_017728822.1.44346 XP_017728823.1.44346 ENSMMUP00000012041 9544.ENSMMUP00000012041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]