SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012044 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012044
Domain Number 1 Region: 28-305
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.16e-101
Family Thioesterases 0.000000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012044   Gene: ENSMMUG00000009189   Transcript: ENSMMUT00000012847
Sequence length 306
Comment pep:known chromosome:MMUL_1:1:42942165:42959351:-1 gene:ENSMMUG00000009189 transcript:ENSMMUT00000012847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERL
VQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAH
IIPFLG
Download sequence
Identical sequences A0A0D9S7N4 A0A1D5QL55 A0A2K6AH72 A0A2K6CPB9 Q8HXW6
NP_001248261.1.72884 NP_001270850.1.63531 XP_007977472.1.81039 XP_011761929.1.29376 XP_011833041.1.47321 ENSMMUP00000012044 ENSMMUP00000012042 9544.ENSMMUP00000012042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]