SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012071 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012071
Domain Number 1 Region: 26-297
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 6.8e-84
Family ATP synthase (F1-ATPase), gamma subunit 0.000000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012071   Gene: ENSMMUG00000009207   Transcript: ENSMMUT00000012874
Sequence length 298
Comment pep:known chromosome:MMUL_1:9:7984223:8001210:1 gene:ENSMMUG00000009207 transcript:ENSMMUT00000012874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARIYGLGSLALYEKADIKVPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVAT
LTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNRFRSVISYKTEEKPIFSLNTIASAESMSIYDDIDADVLQNYQEYNLANIIYY
SLKESSTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
Download sequence
Identical sequences A0A0D9RLW4 A0A2K5UQ24 A0A2K6D1E9 I0FJ47
ENSMMUP00000012071 XP_008000411.1.81039 XP_011760979.1.29376 XP_015001911.1.72884 XP_015310946.1.63531 9544.ENSMMUP00000012071 ENSMMUP00000012071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]