SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012109 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012109
Domain Number 1 Region: 35-136
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-26
Family Ankyrin repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012109   Gene: ENSMMUG00000009243   Transcript: ENSMMUT00000012918
Sequence length 154
Comment pep:known chromosome:MMUL_1:16:77253030:77254579:-1 gene:ENSMMUG00000009243 transcript:ENSMMUT00000012918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVRRFIRAQKVSLATI
HPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLG
ADRDAANDDGDLPSDLIDPDFKELVELFKGATMD
Download sequence
Identical sequences A0A096NTI6 A0A2K5NA91 A0A2K5Z7E8 A0A2K6D717 F7H8H6 G7PT53
9544.ENSMMUP00000012109 ENSPANP00000016357 ENSMMUP00000012109 NP_001181466.1.72884 XP_005585319.1.63531 XP_011718518.1.29376 XP_011850921.1.47321 XP_011921509.1.92194 ENSMMUP00000012109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]