SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012123 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012123
Domain Number 1 Region: 78-226
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.67e-40
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 210-288
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 2.75e-22
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012123   Gene: ENSMMUG00000009256   Transcript: ENSMMUT00000012935
Sequence length 311
Comment pep:known chromosome:MMUL_1:13:89219320:89273957:1 gene:ENSMMUG00000009256 transcript:ENSMMUT00000012935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTST
SCGDSSSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVK
QENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLT
QEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELR
MAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQD
GSVNMREKPFC
Download sequence
Identical sequences A0A096N5R7 A0A0D9RV42 A0A2K5LTJ5 A0A2K5USK7 A0A2K6AN76 F7H8C8 G3SGC2 H2QIB4
ENSPANP00000007780 ENSGGOP00000027158 ENSMMUP00000012123 9544.ENSMMUP00000012123 9598.ENSPTRP00000020877 NP_001245055.1.72884 XP_004031424.1.27298 XP_005575397.1.63531 XP_008006657.1.81039 XP_011764365.1.29376 XP_011943942.1.92194 XP_525809.2.37143 ENSPTRP00000020877 ENSMMUP00000012123 ENSGGOP00000027158 ENSPTRP00000020877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]