SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012171 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012171
Domain Number 1 Region: 379-457
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000813
Further Details:      
 
Domain Number 2 Region: 142-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 38-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012171
Domain Number - Region: 289-294
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012171   Gene: ENSMMUG00000018871   Transcript: ENSMMUT00000012985
Sequence length 464
Comment pep:known chromosome:MMUL_1:15:92700915:92710411:-1 gene:ENSMMUG00000018871 transcript:ENSMMUT00000012985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF
Download sequence
Identical sequences A0A0N8DTE0 A0A1L5BWY7 A0A1S3A2R9 A0A1S3GE42 A0A250YIN0 A0A287CYM1 A0A2I2Z071 A0A2I3LSM4 A0A2J8WPB8 A0A2K5E076 A0A2K5J1F3 A0A2K5MP02 A0A2K6A2W9 A0A2K6E9E8 A0A2K6F7W1 A0A2K6N3U0 A0A2K6PEY0 F6VJH6 F7IK44 G1P5R3 G1QTU8 G5ARM9 K7C562 K9IKG5 Q4R4M6 Q5D059 Q5FWJ5 Q5R5H8
ENSP00000365439 ENSP00000365458 ENSCJAP00000007006 ENSCJAP00000046691 ENSMUSP00000112104 ENSGGOP00000015125 ENSDNOP00000000018 ENSRNOP00000025980 ENSPANP00000019336 ENSMMUP00000012171 ENSPPYP00000021658 ENSP00000365439 ENSP00000365458 ENSMLUP00000005368 ENSCHOP00000009590 ENSMMUP00000024832 gi|14165437|ref|NP_112553.1| gi|14165439|ref|NP_002131.2| ENSP00000317788 ENSCHOP00000009590 10090.ENSMUSP00000112104 10116.ENSRNOP00000025980 13616.ENSMODP00000010448 9544.ENSMMUP00000024832 9598.ENSPTRP00000036000 9600.ENSPPYP00000021658 9606.ENSP00000365439 ENSGGOP00000015125 HGL_H00000365444-2 ENSMUSP00000039269 ENSPPYP00000021658 ENSCJAP00000006994 ENSMLUP00000005368 NP_001126766.1.23681 NP_001253875.1.72884 NP_001270741.1.63531 NP_001288269.1.92730 NP_001288270.1.92730 NP_001288272.1.92730 NP_001295278.1.31192 NP_002131.2.87134 NP_002131.2.92137 NP_112553.1.87134 NP_112553.1.92137 XP_001155079.1.37143 XP_001155315.1.37143 XP_001489114.1.31192 XP_002742831.1.60252 XP_002915066.1.58354 XP_003267511.1.23891 XP_003267513.1.23891 XP_003407837.1.64505 XP_003809221.1.60992 XP_003809223.1.60992 XP_003941169.1.74449 XP_004048233.1.27298 XP_004048234.1.27298 XP_004381361.1.4749 XP_004407651.1.74151 XP_004407652.1.74151 XP_004449511.1.11602 XP_004449512.1.11602 XP_004449513.1.11602 XP_004677586.1.23501 XP_004716019.1.18182 XP_004716020.1.18182 XP_004774144.1.14098 XP_004774145.1.14098 XP_004774146.1.14098 XP_005252017.1.92137 XP_005340973.1.77405 XP_005340974.1.77405 XP_005340976.1.77405 XP_005582093.1.63531 XP_005582095.1.63531 XP_006100065.1.53796 XP_006100066.1.53796 XP_006100067.1.53796 XP_006100069.1.53796 XP_006100070.1.53796 XP_006169047.1.99106 XP_006169048.1.99106 XP_006169050.1.99106 XP_006253614.1.100692 XP_006253615.1.100692 XP_006517166.1.92730 XP_006517167.1.92730 XP_006744254.1.47382 XP_006744255.1.47382 XP_006835023.1.41390 XP_006916147.1.64745 XP_006916148.1.64745 XP_006916149.1.64745 XP_006939191.1.62641 XP_006939192.1.62641 XP_007087631.1.5354 XP_007087632.1.5354 XP_007498960.1.35504 XP_007528445.1.11023 XP_007937112.1.48129 XP_008140249.1.99482 XP_008140251.1.99482 XP_008539329.1.77740 XP_008539330.1.77740 XP_008694025.1.72690 XP_008694026.1.72690 XP_008847628.1.79516 XP_008847629.1.79516 XP_008959607.1.60992 XP_008959608.1.60992 XP_008992717.1.60252 XP_008992727.1.60252 XP_008992737.1.60252 XP_009455059.1.37143 XP_009455060.1.37143 XP_010350148.1.74449 XP_010382313.1.97406 XP_010382314.1.97406 XP_010382315.1.97406 XP_010382316.1.97406 XP_010631224.1.5607 XP_010631225.1.5607 XP_010631226.1.5607 XP_010631227.1.5607 XP_010631228.1.5607 XP_011217746.1.58354 XP_011217747.1.58354 XP_011217748.1.58354 XP_011286562.1.62641 XP_011286563.1.62641 XP_011286564.1.62641 XP_011370352.1.92234 XP_011370353.1.92234 XP_011370354.1.92234 XP_011370356.1.92234 XP_011370357.1.92234 XP_011769363.1.29376 XP_011769364.1.29376 XP_011769365.1.29376 XP_011809373.1.43180 XP_011809374.1.43180 XP_011809375.1.43180 XP_011838130.1.47321 XP_011838131.1.47321 XP_011838132.1.47321 XP_011912241.1.92194 XP_012327548.1.9421 XP_012327549.1.9421 XP_012327550.1.9421 XP_012356167.1.23891 XP_012398530.1.9362 XP_012495483.1.63892 XP_012495484.1.63892 XP_012495485.1.63892 XP_012495486.1.63892 XP_012495487.1.63892 XP_012576906.1.23501 XP_012635264.2.48125 XP_012635265.2.48125 XP_012635266.2.48125 XP_012669156.1.62490 XP_012669161.1.62490 XP_012886524.1.60039 XP_012902094.1.14098 XP_012902095.1.14098 XP_013220950.1.77405 XP_014320939.1.53796 XP_014320940.1.53796 XP_014439849.1.99106 XP_014439850.1.99106 XP_014439851.1.99106 XP_014439852.1.99106 XP_014683997.1.49734 XP_014683998.1.49734 XP_014683999.1.49734 XP_014684000.1.49734 XP_014931756.1.86478 XP_014931757.1.86478 XP_014973460.1.72884 XP_014973461.1.72884 XP_015291959.1.63531 XP_015361549.1.40921 XP_015985862.1.101085 XP_015985863.1.101085 XP_015985864.1.101085 XP_015985865.1.101085 XP_016046014.1.11023 XP_016046015.1.11023 XP_016078454.1.3490 XP_016078455.1.3490 XP_016078456.1.3490 XP_016078457.1.3490 XP_016078458.1.3490 XP_016816528.1.37143 XP_017535248.1.32401 XP_017535249.1.32401 XP_017535251.1.32401 XP_017535252.1.32401 XP_017657776.1.79516 XP_017727871.1.44346 XP_017727872.1.44346 XP_017727873.1.44346 XP_017727874.1.44346 XP_017727875.1.44346 XP_017727876.1.44346 XP_017727877.1.44346 XP_018888876.1.27298 XP_018888877.1.27298 XP_019279077.1.44245 XP_019279079.1.44245 XP_019279080.1.44245 XP_019279081.1.44245 XP_019279082.1.44245 XP_019279083.1.44245 XP_019484915.1.44202 XP_019484916.1.44202 XP_019484917.1.44202 XP_019484918.1.44202 XP_019484919.1.44202 XP_019605696.1.88060 XP_019605697.1.88060 XP_019650537.1.58354 XP_019650538.1.58354 XP_019671380.1.62641 XP_020029287.1.5219 XP_020029288.1.5219 XP_020029289.1.5219 XP_020144847.1.48125 XP_020822678.1.61212 XP_021071425.1.100879 XP_021071426.1.100879 XP_021071427.1.100879 XP_021509958.1.76796 XP_021509959.1.76796 XP_021509960.1.76796 XP_021533627.1.83697 XP_021533628.1.83697 XP_021533629.1.83697 ENSRNOP00000025915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]