SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012182 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012182
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-22
Family PDZ domain 0.00071
Further Details:      
 
Domain Number 2 Region: 280-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000252
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 248-279
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000233
Family LIM domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012182   Gene: ENSMMUG00000009298   Transcript: ENSMMUT00000012997
Sequence length 330
Comment pep:known chromosome:MMUL_1:6:128671798:128687449:1 gene:ENSMMUG00000009298 transcript:ENSMMUT00000012997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRTHIDPEIQDGSPITSRRPS
GTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSR
DCRVDLGSEVYRMLREPAESVAVEPKQSGSFRYLQGMLEAGEGGERPGPGGPRNLKPTAS
KLGSPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCESHAKARVKPPEGYDVVAVYPNAKVELV
Download sequence
Identical sequences F7H1G7
9544.ENSMMUP00000012182 ENSMMUP00000012182 ENSMMUP00000012182 NP_001244732.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]