SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012213 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012213
Domain Number 1 Region: 80-310
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-46
Family Kelch motif 0.0036
Further Details:      
 
Domain Number 2 Region: 281-382
Classification Level Classification E-value
Superfamily NHL repeat 0.0000915
Family NHL repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012213   Gene: ENSMMUG00000009325   Transcript: ENSMMUT00000013031
Sequence length 442
Comment pep:known chromosome:MMUL_1:3:167443578:167507866:1 gene:ENSMMUG00000009325 transcript:ENSMMUT00000013031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPGKKKI
RWDPVRRRFIQSCPIIRIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGP
DNEDYPLFRELWRYHFATGVWHQMGTDGYMPRELASMSLVLHGNNLLVFGGTGIPFGESN
GNDVHVCNVKYKRWALLSCRGKKPSRIYGQAMAIINGSLYVFGGTTGYIYSTDLHKLDLN
TREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWE
EIATKPHEKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQTFQWVKLPATM
PEPVYFHCAAVTPAGCMYIHGGVVNIHENKRTGSLFKIWLVVPSLLELAWEKLLAAFPNL
ANLSRTQLLHLGLTQGLIERLK
Download sequence
Identical sequences A0A096MX45 A0A2K5F5B0 A0A2K5P711 A0A2K5PG61 A0A2K5VV65 A0A2K6EC51 A0A2K6KH07 A0A2K6P805 F6SHC5 G1RQC7 G3QEH2 H2PNI2 H2QVD2 Q6PID8
ENSCJAP00000019489 ENSPTRP00000033724 ENSP00000334140 ENSPPYP00000020195 NP_055812.1.87134 NP_055812.1.92137 XP_001094774.1.72884 XP_002752056.1.60252 XP_002818490.1.23681 XP_003261375.1.23891 XP_004046259.1.27298 XP_005550816.1.63531 XP_007981096.1.81039 XP_010377082.1.97406 XP_011722173.1.29376 XP_011943442.1.92194 XP_012329500.1.9421 XP_017388050.1.71028 XP_017730543.1.44346 XP_519376.2.37143 ENSP00000334140 ENSMMUP00000012214 ENSCJAP00000019489 9544.ENSMMUP00000012214 9598.ENSPTRP00000033724 9600.ENSPPYP00000020195 9606.ENSP00000334140 ENSMMUP00000012213 gi|44917619|ref|NP_055812.1| ENSPPYP00000020195 ENSGGOP00000000666 ENSNLEP00000015441 ENSGGOP00000000666 ENSGGOP00000019579 ENSPTRP00000033724 ENSP00000334140 ENSNLEP00000015441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]