SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012220 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012220
Domain Number 1 Region: 551-846
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-73
Family Protein kinases, catalytic subunit 0.000000926
Further Details:      
 
Domain Number 2 Region: 29-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012220   Gene: ENSMMUG00000009330   Transcript: ENSMMUT00000013038
Sequence length 855
Comment pep:known chromosome:MMUL_1:1:141175766:141332187:1 gene:ENSMMUG00000009330 transcript:ENSMMUT00000013038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSGALPTSPMTPTTYDPMLKIDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQESNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSNVPTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE
Download sequence
Identical sequences A0A096MUC1 A0A2K5L1B9 A0A2K5TSY1 A0A2K6AMM5 G7MEB8
ENSMMUP00000012220 9544.ENSMMUP00000012220 ENSMMUP00000012220 XP_005541180.1.63531 XP_005541182.1.63531 XP_011768542.1.29376 XP_011768543.1.29376 XP_011768544.1.29376 XP_011768545.1.29376 XP_011768546.1.29376 XP_011768547.1.29376 XP_011922835.1.92194 XP_011922836.1.92194 XP_011922837.1.92194 XP_011922838.1.92194 XP_011922839.1.92194 XP_014969572.1.72884 XP_014969574.1.72884 XP_015309840.1.63531 ENSPANP00000003422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]