SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012284 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012284
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-24
Family Growth factor receptor domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 169-252
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.03e-23
Family Thyroglobulin type-1 domain 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012284   Gene: ENSMMUG00000009384   Transcript: ENSMMUT00000013106
Sequence length 258
Comment pep:known chromosome:MMUL_1:16:50561254:50575894:1 gene:ENSMMUG00000009384 transcript:ENSMMUT00000013106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDE
GDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHR
ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
LEPKGELDCHQLADSFRE
Download sequence
Identical sequences A0A024R1U8 A0A0D9S313 A0A2K5MCV1 A0A2K5VE67 A0A2K6DN41 F7HF07 G1QN01 G3R338 K7DL52 P22692
ENSNLEP00000002317 ENSP00000269593 ENSMMUP00000012284 ENSP00000269593 NP_001247475.1.72884 NP_001543.2.87134 NP_001543.2.92137 XP_003278315.1.23891 XP_004041820.1.27298 XP_005584157.1.63531 XP_008010978.1.81039 XP_011723542.1.29376 XP_011901924.1.92194 9544.ENSMMUP00000012284 9606.ENSP00000269593 ENSNLEP00000002317 gi|62243290|ref|NP_001543.2| ENSP00000269593 ENSMMUP00000012284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]