SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012316 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012316
Domain Number 1 Region: 1185-1301,1329-1408
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-46
Family DBL homology domain (DH-domain) 0.0000012
Further Details:      
 
Domain Number 2 Region: 1559-1679
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-28
Family PLC-like (P variant) 0.0044
Further Details:      
 
Domain Number 3 Region: 1097-1183
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-27
Family SH3-domain 0.00000298
Further Details:      
 
Domain Number 4 Region: 229-331
Classification Level Classification E-value
Superfamily EF-hand 1.89e-27
Family Eps15 homology domain (EH domain) 0.0024
Further Details:      
 
Domain Number 5 Region: 10-106
Classification Level Classification E-value
Superfamily EF-hand 1.05e-25
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 6 Region: 975-1036
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-19
Family SH3-domain 0.0000294
Further Details:      
 
Domain Number 7 Region: 1044-1115
Classification Level Classification E-value
Superfamily SH3-domain 9.71e-16
Family SH3-domain 0.0000201
Further Details:      
 
Domain Number 8 Region: 1408-1545
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000197
Family Pleckstrin-homology domain (PH domain) 0.0000227
Further Details:      
 
Domain Number 9 Region: 867-937
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000801
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 10 Region: 757-836
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000127
Family SH3-domain 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012316   Gene: ENSMMUG00000009408   Transcript: ENSMMUT00000013139
Sequence length 1689
Comment pep:known chromosome:MMUL_1:13:24119525:24232688:-1 gene:ENSMMUG00000009408 transcript:ENSMMUT00000013139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVVYSTYVSGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLAE
IWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMGS
MPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPAPLVPSVSTSSLPNGTASLIQPLSIP
YSSSTLPHGSSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAVP
QPSRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADIDGDGQLKAEE
FILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKIQEEEPQKKLPV
TFEDKRKANYERGNMELEKRRQALVEQQQREAERKAQKEKEEWERKQRELQEQEWKKQLE
LEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLNQKNREQEEI
VRLNSKKKSLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQ
QELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKQELCQRLKEQLDA
LEKETASKLSEMDSYNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRETCNTQQLAL
EQLYKIKRDKLKEIERKRLELIQKKKLEDEAARIVILLLISLVYENLNSSREDKSKRAEL
HKVLEGIYKQKRLFEFKQRKDKDTLKVEEKQRETASVLVNYRALYPFEARNHDEMSFNSG
DIIQIRLKTLGKAEWIQHDFNRYDTVKCNYVEKMPSSENEKAVSPKKALLPPTVSLSATS
TSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENLK
AQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFSVVHSKQIINLYIALVFSYTKRSRPE
ALYAAINKKPTSAAYSVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDR
SGIFPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKK
NTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDE
LSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQTLDTMQP
IERKRQGYIHELIQTEERYMADLQLVVEVFQKRMAESGFLTEGEMALIFVNWKELIMSNT
KLLKKRLNHYTTYQSMIPRYKVSLTLAGQKSQRRAAARSAACDLRDAKMIQYKKDSEKYE
NPVLLKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKLALER
AEELCSQVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKT
KSNKELHGFLFNDFLLLTYMVKQFAVSSGSEKLFSSKSNAQFKMYKTREPFAPAVVGARS
SCPQSQHLTHLDGDFSRNKTFDTRTAWVQKIKAASEQYIDTEKKKREKAYQARSQKTSGI
GRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLY
QDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPVTRRLLLHEVPTGEVWVRFDL
QLFEQKTLL
Download sequence
Identical sequences 9544.ENSMMUP00000012316 ENSMMUP00000012316 ENSMMUP00000012316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]