SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012320 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000012320
Domain Number - Region: 248-361
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00468
Family APC10-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012320   Gene: ENSMMUG00000009414   Transcript: ENSMMUT00000013144
Sequence length 376
Comment pep:known chromosome:MMUL_1:10:31544200:31566610:1 gene:ENSMMUG00000009414 transcript:ENSMMUT00000013144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSSRSPGDPGAPLEDVAHNPRPRRIAQRGRNTSRMVEDTSSNMNDNFLLPVRINAQAL
GLTQCMLGCVSWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSI
HLPSKMKVWQDDSINGPLQSLRLYQEKVRHHSGEIQDLRGSMNLLIAKLQEMEAMSDEQK
VAQKIMKMIHGDYIEKPDFALKSTGASIDFEHTSATYNHEKAHSYWNWIQLWNYAQPPDL
AEEPNVTPGNCWAFEGNRGQVTIQLAQKVYLSNLTLQHIPKTISPSGSLDTAPKDFVIYG
MEGSPKEEVFLGAFQFQPESIIQMFPLQNQPARAFGAVKVKISSNWGNPAFTCLYRVRVH
GSVAPPXEQASPEPLP
Download sequence
Identical sequences 9544.ENSMMUP00000012321 ENSMMUP00000012321 ENSMMUP00000012320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]