SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012326 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012326
Domain Number 1 Region: 13-272
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-37
Family WD40-repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 283-372
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.46e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012326
Domain Number - Region: 361-395
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0722
Family Quinoprotein alcohol dehydrogenase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012326   Gene: ENSMMUG00000009421   Transcript: ENSMMUT00000013152
Sequence length 400
Comment pep:known chromosome:MMUL_1:17:30401200:30570714:1 gene:ENSMMUG00000009421 transcript:ENSMMUT00000013152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEESVISVSEDRTVRVWLKRDSGQYW
PSIYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTSVKNYQAHQSRVTMI
LFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVT
ILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQG
HNDKVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQ
MWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTA
TFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Download sequence
Identical sequences ENSMMUP00000012326 ENSMMUP00000012326 9544.ENSMMUP00000012326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]