SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012343 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012343
Domain Number 1 Region: 143-369
Classification Level Classification E-value
Superfamily SET domain 3.01e-82
Family Histone lysine methyltransferases 0.0000148
Further Details:      
 
Domain Number 2 Region: 30-92
Classification Level Classification E-value
Superfamily Chromo domain-like 8.61e-16
Family Chromo domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012343   Gene: ENSMMUG00000019768   Transcript: ENSMMUT00000013170
Sequence length 412
Comment pep:known chromosome:MMUL_1:X:46557833:46570084:1 gene:ENSMMUG00000019768 transcript:ENSMMUT00000013170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
Download sequence
Identical sequences A0A096N1M7 A0A0D9RLA0 A0A2J8R8L7 A0A2K5MJD2 A0A2K5VYE5 A0A2K5Z7S7 A0A2K6AUZ2 A0A2K6M1Q9 G3S7R4 H9Z1X5 K7BV56 O43463 Q5RB81
NP_001248256.1.72884 NP_003164.1.87134 NP_003164.1.92137 XP_003807267.1.60992 XP_004064151.1.27298 XP_005593543.1.63531 XP_007989804.1.81039 XP_011760170.1.29376 XP_011846803.1.47321 XP_011887655.1.92194 XP_016799290.1.37143 XP_016802986.1.37143 XP_017710917.1.44346 HR3128 ENSMMUP00000012343 gi|4507321|ref|NP_003164.1| ENSP00000365877 ENSP00000471677 ENSMMUP00000012343 ENSP00000365877 9544.ENSMMUP00000012343 9606.ENSP00000365877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]