SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012347 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012347
Domain Number 1 Region: 41-340
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.04e-52
Family Carbon-carbon bond hydrolase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012347   Gene: ENSMMUG00000009441   Transcript: ENSMMUT00000013175
Sequence length 342
Comment pep:known chromosome:MMUL_1:7:85404323:85416628:1 gene:ENSMMUG00000009441 transcript:ENSMMUT00000013175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDLEQQPQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVT
VSPEQKDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGA
EDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTN
PSEIRAPPTWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISE
YIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSNTWIDTSTGKK
VKMQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICDSVD
Download sequence
Identical sequences A0A096NRN6 A0A2K5L3I8 A0A2K5TU58 A0A2K6AGY3 A0A2K6C8S3 H9Z1B3
ENSPANP00000015706 ENSMMUP00000012347 NP_001247685.1.72884 XP_005560854.1.63531 XP_011770678.1.29376 XP_011846008.1.47321 XP_011943932.1.92194 9544.ENSMMUP00000012347 ENSMMUP00000012347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]