SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012363 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012363
Domain Number 1 Region: 7-539
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.63e-88
Family Acetylcholinesterase-like 0.000000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012363   Gene: ENSMMUG00000009454   Transcript: ENSMMUT00000013192
Sequence length 544
Comment pep:known chromosome:MMUL_1:20:53979211:54003584:1 gene:ENSMMUG00000009454 transcript:ENSMMUT00000013192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGIPFAKPPLGPLRFTPPQPAEPWS
FVKNATSYPPMCIQDPKAGQFLSDLLSNRKENISLKVSEDCLYLNIYTPADLTKKNRLPV
MVWIFGGGLVVGAASTYDGKVLAAHENVVVVTIQHRLGILGFFRSVGAHSPHFLLEIWQV
QEARMESSPSGLHGDRSQISFKFPNNSCKSSVVLSLSTFKLQLTVSERILSRVIIVTPPD
LPYETNPLPSMKLVLQNTPACALCARLCRSCTSRKRRRKLASSYSYPHTPTVIDGVVLPK
TPEELQAERKFLTVPYIIGINKKEFGWFLPTQLMGYPLSEGKLDQKTAMSLLWKSYPLVE
SWEHIPKELIPEATEKYLGGTDDPVKKKDLFLDLMGDVMFGVPSVIVARHHRDAGAPTYM
YEFQYRPSFSSDMKPKTVIGDHGDELFSVLGAPFLKGNGSLLLFFFFPTEGASEEEIRLS
KMMMKFWANFARSGNPNGEGLPHWPEYDQKEGYLQIGANTQVAQKLKDKEVVFWTNLFKK
AAEQ
Download sequence
Identical sequences 9544.ENSMMUP00000012363 ENSMMUP00000012363 ENSMMUP00000012363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]