SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012398 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012398
Domain Number 1 Region: 52-140
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000774
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 2 Region: 135-281
Classification Level Classification E-value
Superfamily LigT-like 0.0000314
Family 2'-5' RNA ligase LigT 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012398   Gene: ENSMMUG00000009479   Transcript: ENSMMUT00000013228
Sequence length 357
Comment pep:known chromosome:MMUL_1:9:64782933:64896654:1 gene:ENSMMUG00000009479 transcript:ENSMMUT00000013228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFR
STVRAPSLLYKHIVGRRGDTRKKIEMETKTSISIPKPGEDGEIVITGQHRNGVISARTRI
DVLLDTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHL
TIGMLVLLSEEEIQQTCEMLQKCKEEFINDISGGKPLEVEMAGIEYMNDDPGMVDVLYAK
VHMKDGSNRLQELVDRVLERFQASGLIVKEWNSVKLHATVMNTLFRKDPNAEGRYNLYTA
DGKYIFKERESFDGRNILKLFENFYFGSLKLNSIHISQRFTIDSFGNYASCGQIDFS
Download sequence
Identical sequences A0A096P4R5 A0A2K5W136 A0A2K5XWD9 I0FS71
ENSMMUP00000012398 ENSPANP00000020340 XP_007961308.1.81039 XP_011846491.1.47321 XP_011846492.1.47321 XP_015002840.1.72884 XP_015002841.1.72884 XP_015311373.1.63531 9544.ENSMMUP00000012398 ENSMMUP00000012398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]