SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012420 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012420
Domain Number 1 Region: 130-430
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.3e-105
Family Pancreatic carboxypeptidases 0.000000245
Further Details:      
 
Domain Number 2 Region: 35-125
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.23e-25
Family Pancreatic carboxypeptidase, activation domain 0.0000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012420   Gene: ENSMMUG00000009494   Transcript: ENSMMUT00000013251
Sequence length 436
Comment pep:known chromosome:MMUL_1:3:167729086:167753224:1 gene:ENSMMUG00000009494 transcript:ENSMMUT00000013251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGTPAGGTSPGPSPMDRQTLLVFSLILAAALGQMNFTGDQVLRVLAKDEKQLSLLRDLE
GLKPQKVDFWRGPARPSLPVDMRVPFSELKYIKAYLESHGLAYSIMIKDIQVLLDEEREA
MAKSRRLERSTSSFSYSSYHTLEEIYSWIDNFVTEHSNIVSKIQIGNSFENRSILVLKFS
TGGSRHPAIWIDTGIHSREWITHATGIWTANKIVSDYGKDRVLTDILKAMDIFIELVTNP
DGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGGNGSNSNPCSETYHGPSPQSE
PEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRSLEPVSNQRELYDLAKDAVEALYKV
HGIEYFFGSISTTLYVASGITVDWAYDSGIKYAFSFELRDTGRYGFLLPATQIIPTAQET
WMALRTIMEHTLNHPY
Download sequence
Identical sequences A0A1D5RCX2 G7P0U2
ENSMMUP00000012420 9544.ENSMMUP00000034813 ENSMMUP00000034813 XP_014990403.1.72884 XP_014990404.1.72884 XP_014990405.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]