SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012433 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012433
Domain Number 1 Region: 53-316
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-49
Family RecA protein-like (ATPase-domain) 0.0000000142
Further Details:      
 
Domain Number 2 Region: 315-407
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 6.02e-32
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00001
Further Details:      
 
Domain Number 3 Region: 4-50
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000000000235
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012433   Gene: ENSMMUG00000009505   Transcript: ENSMMUT00000013265
Sequence length 407
Comment pep:known chromosome:MMUL_1:X:53851043:53852292:-1 gene:ENSMMUG00000009505 transcript:ENSMMUT00000013265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTLNALEVQGRKTRLILEVAQHLGESTVRTTAVGGTEGLVRGQKVLDSGASIKIPVGPET
LGRIMNVIKEPDERGPIKTTQFAPIHAEAPEFMEMSVEQEILVTDIKVTRSASSLCQGWQ
NLFDGAGVGKTVVIMELVGNVAKAHGGYSVFAGVGDRTREGNDLFCDLKTCHLQDSAGIR
QMIEPPGARAQVTLTGLIVVEYFTDQEGQDVLLFIDKICCFIQARAEVSALSGGIHSAVG
YQPTLTTDMSTMQEIITTTKKGSITSVQAIYVPADDLTDPASATTFAHLDVLSQVIAELG
ICPAVDPLDSTSCIIDPNIVGDEHYDVAHGVQKIPQDYKSLQGLIAILGMDELSQDDKLT
MSCAQKIRCYLSQPFQVVEVFTGHMRKLVPLKDTIKILPGEYDHLPE
Download sequence
Identical sequences 9544.ENSMMUP00000012433 ENSMMUP00000012433 ENSMMUP00000012433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]