SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012457 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012457
Domain Number 1 Region: 2-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-52
Family BAR domain 0.000000535
Further Details:      
 
Domain Number 2 Region: 457-599
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-21
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 
Domain Number 3 Region: 265-337
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000389
Family Pleckstrin-homology domain (PH domain) 0.0000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012457   Gene: ENSMMUG00000009524   Transcript: ENSMMUT00000013291
Sequence length 649
Comment pep:known chromosome:MMUL_1:11:106311041:106363747:-1 gene:ENSMMUG00000009524 transcript:ENSMMUT00000013291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLAYEKQNFALGK
GDEEVISTLHYFSKVVDELNVLHTELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLAS
HEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSHLSSLQYYCALNALQYRKR
MAMMEPMIGFAHGQINFFKKGAEMFSKHMDSFLSSVADMVQSIQVELEAEAEKMRVSQQE
FLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQP
RGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGKACMVEEWLGLESWSSWIIRG
GRQMNLTVESKTWSVRVNPVAFSWVNVCLRFVKLQKCLIQNLKNSEMENENDKIVPNATA
SLPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNPFGETEDESFPEAEDSLLQQMFI
VRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQSLRLIDPQTQVSR
ANFELTSVTQFAAHQENKRLVGFVIRIPESTGEESLSTYIFESNSEGEKICYAINLGKEI
IAVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDNDGNSSEHRGAESEA
Download sequence
Identical sequences 9544.ENSMMUP00000012460 ENSMMUP00000012460 ENSMMUP00000012457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]