SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012532 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012532
Domain Number 1 Region: 53-131
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 9.16e-29
Family Cytochrome b5 0.0029
Further Details:      
 
Domain Number 2 Region: 371-518
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.27e-27
Family Reductases 0.01
Further Details:      
 
Domain Number 3 Region: 267-384
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.97e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00061
Further Details:      
 
Domain Number 4 Region: 167-256
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000000802
Family GS domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012532   Gene: ENSMMUG00000009585   Transcript: ENSMMUT00000013377
Sequence length 521
Comment pep:known chromosome:MMUL_1:4:79895033:79944990:1 gene:ENSMMUG00000009585 transcript:ENSMMUT00000013377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEE
ELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESM
LKECLVGRMAIKPAVLKDYREEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTNSLVT
IAIYTKQKDINLDSIIVDHQDDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKI
EIVLKKKENTSWDFLGHPLENHNSLIPRKDTGLYYRKCQLISKENVTHDTRLFCLMLPPS
THLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYHTGLF
TPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLK
RNLDKSKVLVCICGPVPFTEQGVRLLQDLNFSKNEIHSFTA
Download sequence
Identical sequences A0A2K5Z0F1 F7ADF0
NP_001180696.1.72884 XP_011856591.1.47321 ENSMMUP00000012532 9544.ENSMMUP00000012531 ENSMMUP00000012531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]