SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012611 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012611
Domain Number 1 Region: 139-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.56e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012611   Gene: ENSMMUG00000009640   Transcript: ENSMMUT00000013459
Sequence length 381
Comment pep:known chromosome:MMUL_1:11:72536985:72548877:-1 gene:ENSMMUG00000009640 transcript:ENSMMUT00000013459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSLERREKGAGKSEFRNQKTKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSF
STLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLI
KLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTN
CYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWE
RFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKME
AIKAKQAEALSKKQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGA
LTAEEIALKMEADEKKKKKKK
Download sequence
Identical sequences I2CT59
9544.ENSMMUP00000012611 ENSMMUP00000012611 NP_001252643.1.72884 ENSMMUP00000012611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]