SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012630 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012630
Domain Number 1 Region: 309-401
Classification Level Classification E-value
Superfamily Immunoglobulin 9.31e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 149-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 225-288
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000745
Family Pre-dockerin domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012630
Domain Number - Region: 492-550
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00294
Family Carboxypeptidase regulatory domain 0.053
Further Details:      
 
Domain Number - Region: 54-173
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.0745
Family Vitelline membrane outer protein-I (VMO-I) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012630   Gene: ENSMMUG00000009659   Transcript: ENSMMUT00000013481
Sequence length 1184
Comment pep:known chromosome:MMUL_1:7:43673717:43689619:-1 gene:ENSMMUG00000009659 transcript:ENSMMUT00000013481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKRNPSIFSKPADILESPGEWTTWF
NIDYPGGKGDYERLDAIRFYYGDRVCARPLWLEARTTDWTPAGNTGQVVHGSPREGFWCL
NREQRPGQNCSNYTVRFLCPPGSLRRDTEHIWSLWSPWSKCSAACGQTGVQTRTRTCLAE
TVSLCSEATEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFMLHGAVSLPGGAPASG
ATVYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKVKFAPIVLTMPKTSLKAATIN
AEFVRAEIPYMVMNPETKARRAGQSVSLCCKAKGKPSPDKYFWYHNDTLLDPSHYKHESK
LVLRNLQQDQAGEYFCKAQSDAGAVKSKVAQLIVIAPDETPCNPVPESYLIRLPHDCFQN
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKEC
SCQRCTETRSIVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLT
FVDRLQKFVNTTKVLPFNKKGSAVFHEIKMLRRKEPITLEAMETNIIPLGEMVGEDPMAE
LEIPSKSFYRQNGEPYTGKVKASVTFLDPRNISTATAAQSDLNFINDEGDTFPLRTYGMF
SVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWSLNPDTGLWEEESDFKFENQR
RNKREDRTFLVGNMEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQIQGVVISVINL
EPRTGFSSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESFP
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLR
ACEEAPPSAAHFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKI
VGPLEVNVRSRNMGGTHRRTVGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRV
DRTLVKVIPQGSCRRASVNPMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVT
DQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCVERQVGRQSAFQYLQSTPARS
PAAGTVQGRVPLRRQQRASRSGQRQRGAVASLRFPRVAQQPLIN
Download sequence
Identical sequences A0A2K6BSG8 F6YJ87 G7P8U8
XP_011750887.1.29376 XP_014997963.1.72884 9544.ENSMMUP00000012630 ENSMMUP00000012630 ENSMMUP00000012630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]