SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012676 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012676
Domain Number 1 Region: 339-439
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.3e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 156-210,238-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012676   Gene: ENSMMUG00000009690   Transcript: ENSMMUT00000013529
Sequence length 626
Comment pep:known chromosome:MMUL_1:14:58501925:58611248:-1 gene:ENSMMUG00000009690 transcript:ENSMMUT00000013529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDED
NEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAIL
AYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWF
SFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTV
PGIPGGTRAGAGKIGRMIAEEIMEIHRQTLGSSPSSCGSSPLNITSTPPPDASSPGGKKI
LNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences ENSMMUP00000012676 ENSMMUP00000036981 9544.ENSMMUP00000036981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]