SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012714 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012714
Domain Number 1 Region: 54-136
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000215
Family Canonical RBD 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012714
Domain Number - Region: 204-272
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0312
Family PhoB-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012714   Gene: ENSMMUG00000009716   Transcript: ENSMMUT00000013568
Sequence length 280
Comment pep:known chromosome:MMUL_1:10:86471510:86493757:-1 gene:ENSMMUG00000009716 transcript:ENSMMUT00000013568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVARRRKRAARDPEDCIPSPPGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRT
LFVLNVPPYCTEESLSRLLSSCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAY
VVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAY
DQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRARKELLN
FYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY
Download sequence
Identical sequences H9Z0Y3 Q4R3Q9
9544.ENSMMUP00000012714 NP_001181302.1.72884 NP_001270336.1.63531 ENSMMUP00000012714 ENSMMUP00000012714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]