SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012794 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012794
Domain Number 1 Region: 296-694,775-780,811-853
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-96
Family FAD-linked reductases, N-terminal domain 0.000000000000859
Further Details:      
 
Domain Number 2 Region: 191-297
Classification Level Classification E-value
Superfamily Homeodomain-like 1.79e-30
Family SWIRM domain 0.00000121
Further Details:      
 
Domain Number 3 Region: 679-787
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012794   Gene: ENSMMUG00000009773   Transcript: ENSMMUT00000013654
Sequence length 876
Comment pep:known chromosome:MMUL_1:1:25595964:25661730:1 gene:ENSMMUG00000009773 transcript:ENSMMUT00000013654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGKKAAAAAAAAAAAAAGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAAGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQD
DSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQL
WLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGK
VIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGN
PMAVVSKQVNMELAKIKQKCPLYEANGQAVRIIVPKEKDEMVEQEFNRLLEATSYLSHQL
DFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIK
ELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPP
SDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPV
ALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPA
VQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWN
LYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPW
ARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALL
SGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences 9544.ENSMMUP00000012795 ENSMMUP00000012794 ENSMMUP00000012795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]