SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012836 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012836
Domain Number 1 Region: 110-355
Classification Level Classification E-value
Superfamily DNase I-like 3.8e-41
Family DNase I-like 0.03
Further Details:      
 
Domain Number 2 Region: 22-59
Classification Level Classification E-value
Superfamily UBA-like 0.0000133
Family TAP-C domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012836   Gene: ENSMMUG00000009803   Transcript: ENSMMUT00000013696
Sequence length 358
Comment pep:known chromosome:MMUL_1:4:24656043:24672755:-1 gene:ENSMMUG00000009803 transcript:ENSMMUT00000013696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGSCLGAAEEEGEPEVKKRRLLCVEFASVASCDSAVAQCFLAENDWEMERALNSYFEP
PVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENDSMFCFITWNIDGL
DLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRASDYEIITGHEEGYFTAIML
KKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMV
LKKMQEAPESATVIFAGDTNLRDQEVTKCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSN
LGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDHWGLLCNLDVIL
Download sequence
Identical sequences A0A2K6CZM7 F6XSC6 G7P4J7
ENSMMUP00000012836 ENSMMUP00000012837 9544.ENSMMUP00000012837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]