SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012847 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012847
Domain Number 1 Region: 76-132
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000204
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012847   Gene: ENSMMUG00000009815   Transcript: ENSMMUT00000013711
Sequence length 156
Comment pep:known chromosome:MMUL_1:10:68126336:68129087:-1 gene:ENSMMUG00000009815 transcript:ENSMMUT00000013711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADKRRSGKYDLAGGGVLGGSPAAVVWLPAGAAGRDAVHPAERIAGAQGAGRPLKLPSRLL
QQPTPGLLGAESGPTLDIPVSIFNDISQDWRLQHFVSWMWYEREVPLLKRWIRDLHIRVV
LRIGSAHFYAIVDYSGLCFCTRHQLPTSMTSPSPPV
Download sequence
Identical sequences 9544.ENSMMUP00000012847 ENSMMUP00000012847 ENSMMUP00000012847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]