SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012877 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012877
Domain Number 1 Region: 349-425
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.98e-19
Family PCI domain (PINT motif) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012877
Domain Number - Region: 252-354
Classification Level Classification E-value
Superfamily TPR-like 0.000455
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number - Region: 69-216
Classification Level Classification E-value
Superfamily TROVE domain-like 0.0144
Family TROVE domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012877   Gene: ENSMMUG00000009838   Transcript: ENSMMUT00000013743
Sequence length 453
Comment pep:known chromosome:MMUL_1:7:27449065:27478424:-1 gene:ENSMMUG00000009838 transcript:ENSMMUT00000013743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLEL
EGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYIS
TSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILR
QLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLI
MGVIRGKFECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG
INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL
LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLE
LDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Download sequence
Identical sequences L8IUU2
ENSMMUP00000012877 ENSMMUP00000012877 ENSETEP00000015858 9544.ENSMMUP00000012877 ENSETEP00000015858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]