SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012905 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012905
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.64e-40
Family Eukaryotic proteases 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012905   Gene: ENSMMUG00000009857   Transcript: ENSMMUT00000013771
Sequence length 222
Comment pep:known chromosome:MMUL_1:8:10235216:10237020:1 gene:ENSMMUG00000009857 transcript:ENSMMUT00000013771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRTFSNIHSERKQVQKVIIHKDYKPPQLDSDLSLLLLATPVQFSNFKMPVCLQEEERT
WDRCWMAEWVMTNGYDQYDDLNMHLEKLRVVQISQKECAKRVNQLSRNMICAWKEPGTNG
ICKGDSGAPLVCAIYGTQRLFQVGVFSWGIRSGSRGRPGMFVSVAQFVPWIQEETEKEGK
AYTIISGSTRSSLVCVPQYLFLLGLGSQMLLATIFTGDKPNC
Download sequence
Identical sequences 9544.ENSMMUP00000012905 ENSMMUP00000012905 ENSMMUP00000012905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]