SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012943 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012943
Domain Number 1 Region: 128-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012943   Gene: ENSMMUG00000009887   Transcript: ENSMMUT00000013812
Sequence length 298
Comment pep:known chromosome:MMUL_1:16:52689291:52695319:1 gene:ENSMMUG00000009887 transcript:ENSMMUT00000013812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPGASPEDPWVKASPVGAHASEGRAGRARARRGAGRRGASLLSPKSPMLSGPRGCRED
SSHPACAKVEYAYSDNSLDPGLFVESTRKGNVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences A0A2I3LGF4 A0A2K5VRN6 A0A2K6BFE4 F6YL60
9544.ENSMMUP00000012943 ENSMMUP00000012943 ENSMMUP00000012943 XP_001110337.1.72884 XP_005584309.1.63531 XP_011723393.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]