SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013028 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013028
Domain Number 1 Region: 43-493
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.16e-142
Family Serine carboxypeptidase-like 0.0000000000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013028   Gene: ENSMMUG00000009960   Transcript: ENSMMUT00000013904
Sequence length 494
Comment pep:known chromosome:MMUL_1:10:18600030:18603586:-1 gene:ENSMMUG00000009960 transcript:ENSMMUT00000013904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSPRAPPGEQGHGGAEMIRAAPPLLFLLLLLVSWAPRGEAAPDQDEIQRLPGLAKQPS
FRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPD
GVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFHLFPE
YKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG
LLGNRLWSSLQTHCCSQNKCNFYDNKDPECVTNLQEVARIVGNSGLNIYNLYAPCAGGVP
SHFRYEKDTVVVQDLGNIFTRLPLKRTWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYV
RKALHIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFM
GDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLA
AFTMFSRFLNKQPY
Download sequence
Identical sequences A0A2K5L7U4 A0A2K6D8B8 F7G1E1
NP_001253780.1.72884 XP_011765205.1.29376 XP_011921249.1.92194 ENSMMUP00000038017 ENSMMUP00000013028 9544.ENSMMUP00000038017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]