SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013158 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013158
Domain Number 1 Region: 92-390
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.93e-113
Family Pancreatic carboxypeptidases 0.00000000149
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.13e-25
Family Pancreatic carboxypeptidase, activation domain 0.00000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013158   Gene: ENSMMUG00000010063   Transcript: ENSMMUT00000014049
Sequence length 395
Comment pep:known chromosome:MMUL_1:3:167650976:167671546:1 gene:ENSMMUG00000010063 transcript:ENSMMUT00000014049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWRSPSTPGETAHIRVPFVSVQAVKAFLESQ
GIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEYPGLV
SKVNIGSSFEKRPLNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIASDYGKNP
SVTSILDTLDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGP
GASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVKAFVTLHSYSQLLMFPYGYKCTKPD
NSDELSEVAQKAAQSLTSLHGTKYKVGPICSVIYQASGGSIDWSYDCGIKYSFAFELRDT
GRYGFLLPAHQILPTAEETWLGLKAIMEHVRDHPY
Download sequence
Identical sequences ENSMMUP00000013158 ENSMMUP00000013158 9544.ENSMMUP00000013158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]