SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013185 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000013185
Domain Number - Region: 46-108
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000337
Family Eukaryotic type KH-domain (KH-domain type I) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013185   Gene: ENSMMUG00000010084   Transcript: ENSMMUT00000014079
Sequence length 206
Comment pep:known chromosome:MMUL_1:4:69597944:69599025:1 gene:ENSMMUG00000010084 transcript:ENSMMUT00000014079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRDR
ERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGK
ALAQDVATKKAEIQLSSTEVREAGTQRSVEVREVGTQGSPVEVRETGTQQSLEAANQSGT
QRSPEAANKAVTQRFREDTRAPVTRL
Download sequence
Identical sequences F6SZT2
ENSMMUP00000013185 9544.ENSMMUP00000013185 XP_001112378.1.72884 ENSMMUP00000013185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]