SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013192 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013192
Domain Number 1 Region: 7-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.39e-31
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.000000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013192   Gene: ENSMMUG00000010090   Transcript: ENSMMUT00000014086
Sequence length 168
Comment pep:known chromosome:MMUL_1:10:68210825:68213419:-1 gene:ENSMMUG00000010090 transcript:ENSMMUT00000014086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCALALLGRMLYLGESPWRERKELDSLWSLPADFSDNRPRGFQEQRYRRLLLESGPTLYI
PVPSIFNDISQDWWLWRFVSWVWYEREVTQLERWIQDLCTRVVLRIGSAHFYAIVWVNGF
DRLEHEGYLPFEADSSSLFQVGPLPSRLCVTVAINNMLAPPALPPGTI
Download sequence
Identical sequences ENSMMUP00000013192 ENSMMUP00000013192 9544.ENSMMUP00000013192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]