SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013195 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013195
Domain Number 1 Region: 300-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-37
Family SPRY domain 0.00027
Further Details:      
 
Domain Number 2 Region: 14-85
Classification Level Classification E-value
Superfamily RING/U-box 1.75e-20
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 98-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000641
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013195   Gene: ENSMMUG00000010092   Transcript: ENSMMUT00000014089
Sequence length 493
Comment pep:known chromosome:MMUL_1:8:27432455:27456946:-1 gene:ENSMMUG00000010092 transcript:ENSMMUT00000014089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVC
KDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLC
CSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEA
AWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIER
LQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVE
SVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEV
ALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPL
VLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRI
CPLHISIKEELDG
Download sequence
Identical sequences A0A096NQI3 A0A2K5V9X6 A0A2K6C3P9 F6STB1
ENSMMUP00000013195 9544.ENSMMUP00000013194 NP_001244485.1.72884 XP_005562956.1.63531 XP_011740161.1.29376 ENSMMUP00000013194 ENSPANP00000015287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]