SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013259 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013259
Domain Number 1 Region: 687-1043
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.19e-112
Family Hect, E3 ligase catalytic domain 0.000000161
Further Details:      
 
Domain Number 2 Region: 2-380
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.02e-102
Family Regulator of chromosome condensation RCC1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013259   Gene: ENSMMUG00000010138   Transcript: ENSMMUT00000014157
Sequence length 1050
Comment pep:known chromosome:MMUL_1:5:81551170:81674464:1 gene:ENSMMUG00000010138 transcript:ENSMMUT00000014157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGYWSLGQPGISTNLQGIVAEPQVCGFISDRSVKEVACGGNHSVFLLEDGEVYTCGL
NTKGQLGHEREGNKPEQIGALADQHIIHVACGESHSLALSDRGQLFSWGAGSDGQLGLMT
TEDSVAVPRLIQKLNQQTILQVSCGNWHCLALAADGQFFTWGKNSHGQLGLGKEFPSQAS
PQRVRSLEGIPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR
TQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRRVLELMGSEVTQIA
CGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTCNVKCPSPVKGYWAAHSGQLSARADRFK
YHIVKQIFSGGDQTFVLCSKYENSSPAVDFRTMNQAHYTSLINDETIAVWRQKLSEHNNA
NTINGVVQILSSAACWNGSFLEKKIDEHFKTSPKIPGIDLNSTRVLFEKLMNSQHSMILE
QILNSFESCLIPQLSSSPPDVEAMRIYLILPEFPLLQDSKYYITLTIPLAMAILRLDTNP
SKVLDNWWSQVCPKYFMKLVNLYKGAVLYLLRGRKTFLIPVLFNNYVTAALKLLEKLYKV
NLKVKHVEYDTFYIPEISSLVDIQEDYLMWFLHQAGMKARPSIIQDTVTLCSYPFIFDAQ
AKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNNLVGDALRELS
IHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSNLLWFSDT
CFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQE
LLDYPGEDVEETFCLNFTICRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQI
SVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHP
TVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMASLQIVIQSTASGEEYLPVAHTCYN
LLDLPKYSSKEILSARLTQALDNYEGFSLA
Download sequence
Identical sequences F6QY96 G7P5W8
ENSMMUP00000013259 ENSMMUP00000013259 9544.ENSMMUP00000013259 NP_001248295.1.72884 XP_005555456.1.63531 XP_005555457.1.63531 XP_005555458.1.63531 XP_014994233.1.72884 XP_014994234.1.72884 XP_014994235.1.72884 XP_015306129.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]