SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013271 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013271
Domain Number 1 Region: 34-51,137-396
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.09e-34
Family Haloperoxidase 0.086
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013271
Domain Number - Region: 88-147
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0582
Family Cytochrome b5 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013271   Gene: ENSMMUG00000010147   Transcript: ENSMMUT00000014169
Sequence length 412
Comment pep:known chromosome:MMUL_1:20:66586761:66603928:1 gene:ENSMMUG00000010147 transcript:ENSMMUT00000014169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLHLRPCRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTV
VHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGK
TFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYSYTWSPEKVFVQTPTTNYTLRDYRRFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGD
GTVNLKSALQCQAWQSLQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Download sequence
Identical sequences A0A1D5RAG6
ENSMMUP00000013271 9544.ENSMMUP00000013271 NP_001252747.1.72884 XP_014981897.1.72884 XP_014981898.1.72884 XP_014981899.1.72884 XP_014981900.1.72884 XP_014981901.1.72884 XP_014981902.1.72884 ENSMMUP00000013271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]