SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013272 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013272
Domain Number 1 Region: 38-321
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.89e-49
Family Glycosylating toxin catalytic domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013272   Gene: ENSMMUG00000010149   Transcript: ENSMMUT00000014171
Sequence length 340
Comment pep:known chromosome:MMUL_1:2:149693937:149702099:1 gene:ENSMMUG00000010149 transcript:ENSMMUT00000014171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKELQLSLSVTLLFACGFLYQFTLKSSFLFCLPSFKSQQGLEALLSHRRGIVFLETSER
MEPTHLVSCAVESAAKIYPERPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLD
MKRLFEDTPLFSWYNQINTSIERNWLHISSDASRLAVIWKYGGIYMDTDVISIRPIPEEN
FLAAQGSRYSSNGVFGFLPQHPFLWKCMENFVEHYNSDIWGNQGPDLMTRMLRVWCKLED
FQELSDLRCLNISFLHPQRFYPISYPEWRRYYEVWDTDPSFNDSYALHLWNYMNQEGRAV
VRGSNTLVENLYRKHCPGTYRDLIQGPEGSVTGELGPGNK
Download sequence
Identical sequences A0A096MVI4 A0A2K5LAI1 A0A2K5VVL3 A0A2K6DFM5 F6QQ20
ENSMMUP00000013272 ENSPANP00000003863 XP_005545929.1.63531 XP_011719853.1.29376 XP_011916746.1.92194 XP_011916749.1.92194 XP_011916750.1.92194 XP_014987564.1.72884 9544.ENSMMUP00000013272 ENSMMUP00000013272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]