SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013332 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013332
Domain Number 1 Region: 92-165
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.49e-19
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 2 Region: 22-92
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.84e-18
Family Thyroglobulin type-1 domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013332
Domain Number - Region: 163-195
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000131
Family Thyroglobulin type-1 domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013332   Gene: ENSMMUG00000010192   Transcript: ENSMMUT00000014234
Sequence length 212
Comment pep:known chromosome:MMUL_1:8:135429149:135435054:1 gene:ENSMMUG00000010192 transcript:ENSMMUT00000014234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVLEIFSLLASVCWVSANIFEYQVDAQPLRPCELQRERAFLKQADYVPQCAEDGSFQP
VQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQC
QDSGDYMPVQCDVQQVQCWCVDAEGMEVYGTRQPGRPKRCPRSCEIRNRRLLHGVGDKSP
PQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYN
Download sequence
Identical sequences ENSMMUP00000013332 9544.ENSMMUP00000013332 ENSMMUP00000013332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]