SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013347 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013347
Domain Number 1 Region: 5-106,200-365
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.95e-70
Family Pyruvate kinase 0.0000000297
Further Details:      
 
Domain Number 2 Region: 101-200
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.45e-17
Family Pyruvate kinase beta-barrel domain 0.00000867
Further Details:      
 
Domain Number 3 Region: 374-458
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 8.7e-17
Family Pyruvate kinase, C-terminal domain 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013347   Gene: ENSMMUG00000010206   Transcript: ENSMMUT00000014250
Sequence length 459
Comment pep:known chromosome:MMUL_1:4:5878732:5880148:1 gene:ENSMMUG00000010206 transcript:ENSMMUT00000014250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTMTQQLHAAMADTFLEHMCCLDTDSPPITAWSTGIICTMGPASPLLEMLKKTIKSGMNV
VHLNSHGTHEYHTETIKNVESFASDSILYQPIAVALDTKGPEIPSGPIKGSGTAEVELKK
GATLKLMLDNTYMEKCENILWLDYKNICKVAEVGSKIYMGDGLISLGEQKDADFLVTEAE
NGGSLGSKKGANLPGAAVDLPAVGEGHRDLKFGDVDMMLASFICKTSDVHGVRQVFIKII
SKIENYVGGWRFDEILEASDGIMVARGDLPHEIPAEKVFLAQKMMIGRCNQAGKPVIATQ
MLEDMIKKLHPTRAEGNGVANAILEGADFIMLSGETAKGDYPLEAVHVQHLTACEAEATI
YHLQLFEEFCHAPITGDPTEATAVSAVEASFKCCSGAIIVLTKSAGGHRGTWARYCPRAP
MIAVTWNPQTARQTHLYHGFFPVLCKDPVQESWAEDVDL
Download sequence
Identical sequences 9544.ENSMMUP00000013347 ENSMMUP00000013347 ENSMMUP00000013347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]