SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013365 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013365
Domain Number 1 Region: 353-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-39
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 3-77
Classification Level Classification E-value
Superfamily RING/U-box 4.2e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 82-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000153
Family B-box zinc-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013365   Gene: ENSMMUG00000010211   Transcript: ENSMMUT00000014269
Sequence length 484
Comment pep:known chromosome:MMUL_1:14:88466692:88472369:-1 gene:ENSMMUG00000010211 transcript:ENSMMUT00000014269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVQAFQNELICSICMNYFIDPVTIDCGHSFCKPCLCLCWEEGRAPMRCPVCRKISAKSDF
NTNAALKKLASLARQTRPQNINNSHNICVLHKETKELFCEADKRLLCGPCTESPEHMAHS
HSPMGWAAEECRLQTFYLIDKGMKSSILSSLLLSFLLLFQEKLIKKMNYLWKINQETQNN
LNQQTSLQDYVSLRKVIITIQYQKMHLLLHEEEQLHLQALEREAEELFQQLQDSQVRMTQ
HLERMKDMYRVLWETCHMPAVELLQVRREGPSSETGNPCWTLLPGHVHVTCICHCSKSSL
KSFLYLVHWSRLFPRKKLLICPETNCAEVDIKSLLCPGIWSLFSLLFKYFLGRRANAPMD
PQGVESFAVWGAQAFTSGRHYWEVDVTHSSTWILGVCRDSRTADTNIVIDSDETFLLISS
KRNNHYSLSTISPPLIQHVQRPLGRVGVFLDYENGSVSFFDVSKSSLIYDFPPSSFSSPL
RPFF
Download sequence
Identical sequences 9544.ENSMMUP00000013360 ENSMMUP00000013360 ENSMMUP00000013365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]