SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013391 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013391
Domain Number 1 Region: 434-781
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.02e-61
Family Ankyrin repeat 0.000029
Further Details:      
 
Domain Number 2 Region: 145-220
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.14e-23
Family Mib/herc2 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 63-137
Classification Level Classification E-value
Superfamily RING/U-box 2.94e-21
Family ZZ domain 0.0053
Further Details:      
 
Domain Number 4 Region: 11-73
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 6.67e-20
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 5 Region: 944-1004
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000442
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013391
Domain Number - Region: 815-859
Classification Level Classification E-value
Superfamily RING/U-box 0.00232
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number - Region: 862-907
Classification Level Classification E-value
Superfamily RING/U-box 0.0162
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013391   Gene: ENSMMUG00000010227   Transcript: ENSMMUT00000014297
Sequence length 1006
Comment pep:known chromosome:MMUL_1:18:14746443:14873376:1 gene:ENSMMUG00000010227 transcript:ENSMMUT00000014297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
RCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHL
RHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGN
RNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPS
GNRWTFNPAVLTKANIVRSGEAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDIL
KLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNK
GHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNAL
HHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLD
IQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQD
MQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLC
PDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC
SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQC
RAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQ
TMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Download sequence
Identical sequences A0A096NB52 A0A0D9RYJ5 A0A2K5JNG5 A0A2K5VQ91 A0A2K6NR48
ENSPANP00000009969 XP_001092086.1.72884 XP_005587110.1.63531 XP_007972665.1.81039 XP_010353180.1.97406 XP_011813161.1.43180 XP_017729014.1.44346 ENSMMUP00000013391 9544.ENSMMUP00000013391 ENSMMUP00000013391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]