SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013408 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013408
Domain Number 1 Region: 124-299
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.82e-57
Family Crystallins/Ca-binding development proteins 0.0000631
Further Details:      
 
Domain Number 2 Region: 312-480
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.61e-45
Family Crystallins/Ca-binding development proteins 0.00067
Further Details:      
 
Domain Number 3 Region: 12-111
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.02e-20
Family Crystallins/Ca-binding development proteins 0.0024
Further Details:      
 
Domain Number 4 Region: 484-614
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.71e-19
Family Ricin B-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013408   Gene: ENSMMUG00000010241   Transcript: ENSMMUT00000014317
Sequence length 616
Comment pep:known chromosome:MMUL_1:1:28941681:28965092:-1 gene:ENSMMUG00000010241 transcript:ENSMMUT00000014317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRTPETKWSPQGIGSLRRVVWDYRTPEISLFSEEGLKGAQVKLREALKNSQGLEKPLQ
VASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRLGCPSVEKP
GEPRAVVYEAPGFQGCSWEVSQDIYNLQQPEDSQSPHLASVGSLRVLGGCWVGYEKEGFR
GHQYLLEEGEYPDWSHWGGYDELLTSLRVIRTDFGDPAIVLFEAMDFEGHGVEVSKALPD
VELVQHGPSTQAIHVLSGVWVAYQEVGFSGEQYVLEKGVYRNCEDWGAGNSALASLQPVL
QVGEHDLHFVSKIQLFSRPDFLGDHFSFEDDQAALPASFRPQSCRVHGGSWILFDEKNFK
GDQHILSEGEFPTLTAMGCLASTVLGSLQKVSLHFSEPSIFLYGLQCFEGKEIELSREVR
SLQAEGFNNHVLSVRIKGGVWVLCEHSDFRGRQWLVGSCEITNWLTYSGIQRVGSLYPIK
QRRVYFRLWNAALGGFLAVPDHVEDMKAGRVVVSDPRAGGSCIWYYEDGLLKNQMAPTMS
LQVIGPPSPGSKVVLWAESRLPRQTWSISESGHICSQMFEGQILDVKGGRGYDRDHVVLW
EPDEDRASQIWTIHVL
Download sequence
Identical sequences ENSMMUP00000013408 ENSMMUP00000013408 9544.ENSMMUP00000013408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]