SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013414 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013414
Domain Number 1 Region: 2190-2345
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.03e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000681
Further Details:      
 
Domain Number 2 Region: 2038-2190
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000206
Further Details:      
 
Domain Number 3 Region: 20-203
Classification Level Classification E-value
Superfamily Cupredoxins 2.93e-46
Family Multidomain cupredoxins 0.0000275
Further Details:      
 
Domain Number 4 Region: 397-584
Classification Level Classification E-value
Superfamily Cupredoxins 2.44e-44
Family Multidomain cupredoxins 0.0000596
Further Details:      
 
Domain Number 5 Region: 1892-2036
Classification Level Classification E-value
Superfamily Cupredoxins 3.39e-41
Family Multidomain cupredoxins 0.0000623
Further Details:      
 
Domain Number 6 Region: 588-730
Classification Level Classification E-value
Superfamily Cupredoxins 3.32e-39
Family Multidomain cupredoxins 0.000092
Further Details:      
 
Domain Number 7 Region: 212-348
Classification Level Classification E-value
Superfamily Cupredoxins 2.22e-33
Family Multidomain cupredoxins 0.00043
Further Details:      
 
Domain Number 8 Region: 1711-1883
Classification Level Classification E-value
Superfamily Cupredoxins 2e-26
Family Multidomain cupredoxins 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013414   Gene: ENSMMUG00000010245   Transcript: ENSMMUT00000014323
Sequence length 2350
Comment pep:known chromosome:MMUL_1:X:152840511:153047501:-1 gene:ENSMMUG00000010245 transcript:ENSMMUT00000014323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIELSTYFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDTRFPPRVPRSFPFN
TSVMYKKTVFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAV
GVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSH
VDLVKDLNSGLIGALLVCREGNLAKEKTQTLHKFVLLFAVFDEGKSWHSETKNSLMQDRD
DASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNH
RQASLEISPITFLTAQTLLMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNE
EAEDYDDDLADSEMDVVRFDDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEVWDYAPSVLA
PDDRSYKSQYLNNGSQRIGRKYKKVRFMAYTDETFKTREAIQYESGILGPLLYGEVGDTL
LIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGP
TKSDPRCLTRYYSSFINMERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDE
NQSWYLTENIQRFLPNPVGVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILS
IGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRG
MTALLKVSSCDKNTGDYYEDSYEDISTYLLSKNNAIEPRSFSQNSRHPSPRQKQFNATTI
PKNDIEKTDPWFAHRTPMPKVQNVSSSDLLMLLRQSPTPHGLSLSDLQEAEYETFSDDPS
PGAIDTNNNLSKMTHLRPQPHHSGDMVFTPEPDLQLRLNEKLGTTVATELKKFDFKVSSS
SNNLISTIPSDNLVAGSDNTSSLGPPNIPVHYESQLDTTLSGKKSSPLIESGGPLSLSEE
NNDSKLLESGLMNSQESSWGKNVWSTESGRLFKEKRAHGPALLTKDNALFKVSISLLKIN
KTSNNSATNRKTHIDGPSLLVENSPSVWQNILESDTEFQKVTPLIHDRMLTDKNTTALRL
NHMSNKTTSSKNMEMVQQKIEGPILPDAENPDMSFFKMLFLPESANWIQRTHGKNSLNSG
QGPSAKLFISLGPENSVEGQNFLSEKNKVVVGKGELTKDIGLKEIVFPSSRNLFLTNLDN
LHENNTHNQEKKIQEEIERKETLIQDNIVLPQIHTVTGTKNFMKNLFLLSTRQNVEGSYE
GAYAPVLQDFRSLSDSTNRTKNHMAHFSEKGEEENLEGLGNQTKQIVEKYPHTTRISPNP
NQQNFVTQRGKRALKQFRLPLEETELEKRLIVEETSTQWSKNIKHLTPSTLTQIDYNEKE
KGAITQSPLSDCLTRSHSITQANRSPLPIAKVSSFPSIRPMDLTRVLFQDNFSRLPAPPY
RKKDSGVQESSHFLQGVKKNNLSLAILTLEMIGDQREVGSLVTSATNSVTYKKVENTVFL
KPGLPETSGKVELLPKVRIYQKDLFPTETSSGSPGHLDLMEGSLLQETEGAIKWKEANRP
GKIPFLRGATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPENTAFKKKDTILPL
NPCESNHTIAAINEEQNEPQIEVTWAKQGGTERLCSQNPPVLKRHQREITLNTLQSDQEE
IDYDDTISVEMKKEDFDIYGEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNR
AQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVSDNGITRK
LILYIYFLADYNVFPLFEMFKKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVD
LEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENTERNCRAP
CNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHV
FTVRKKEEYKMAVYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQ
TPLGMASGRIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIH
GIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNP
PIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFAT
WSPSKARLNLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGITTQGVKSLLTNMYVKEFLI
SSSQDGHHWTLFFQNGKVKVFQGNQDSFTPVVNSLDSPLLTRYLRIHPQSWVHQIALRIE
VLGCEAQELY
Download sequence
Identical sequences ENSMMUP00000013414 9544.ENSMMUP00000013414 ENSMMUP00000013414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]