SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013421 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013421
Domain Number 1 Region: 350-477
Classification Level Classification E-value
Superfamily Second domain of FERM 8.02e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 479-585
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-25
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 3 Region: 103-214
Classification Level Classification E-value
Superfamily PDZ domain-like 2.87e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 261-344
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000475
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013421   Gene: ENSMMUG00000010252   Transcript: ENSMMUT00000014331
Sequence length 1382
Comment pep:known chromosome:MMUL_1:X:9837416:10425440:1 gene:ENSMMUG00000010252 transcript:ENSMMUT00000014331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPPPGAGSLRPPPPPAVAATGALGALRSWPWGCGGCCCCWREKGRRSCRARGSPAACMD
VFSFVKIAKLSSHRTKSSGWPPPSGPWGLNQVPPYGWEMTANRDGRDYFINHMTQAIPFD
DPRLESCQIIPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVM
INDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSE
EVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGI
EHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDP
VAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGL
ETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGR
VFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLVRV
ELHVLDVKASPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQETGTEN
KGKHNLLGPDWNCIPQMTTFIGEGEQEAQITYIDSKQKTVEITDSTICPKEHRHLYIDNT
YSSDALNQQLSQPGEAPCEADYRSLAQQSLLTLSGPETLKKAQESPRGAKVSFIFGDFAL
DDGISPPTLGYETLLDESPEMLEKQRNLYIGSASDMKGLDLTPEAEGIQFVENSVYANIG
DVKSFQAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILNLSGSSDDI
IDLTSLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFPEDKEKGGSL
QNDEIPVSLIDAVPTSAEGKCEKGLDNAVVSTLGALETLSVSEEQQTSDNSGVAILRAYS
PESSSDSGNETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKTPT
GGLHPKSSHTLAARPATDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVA
YSCTSKRKSKLADGEGKAPSNGNTIGKKQQGTKTAEMEEDASGKFGTVSSRDSQHLSTFN
LERTAFRKDSQRWYVATESGMAEKSGLEAATGKTFPRASGLGAREAEGKEEGAPDGETSD
GSGLGQGDHFLTDVTCASSAKDLDNPEDADSSTCDHPSKLPEADESVAHLCDYHLAKRMS
SLQSEGHFSLQSSQGSSVDAGCGTGSSGSACATPVESPLCPSLGKHLIPDASGKGVNYIP
SEERAPGLPNHGATFKELHPQTEGMCPRMTVPALHTAINTEPLFGTLRDGCHRLPKIKET
TG
Download sequence
Identical sequences 9544.ENSMMUP00000013421 ENSMMUP00000013421 ENSMMUP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]