SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013473 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013473
Domain Number 1 Region: 26-254
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-48
Family Nuclear receptor ligand-binding domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013473   Gene: ENSMMUG00000010291   Transcript: ENSMMUT00000014383
Sequence length 257
Comment pep:known chromosome:MMUL_1:1:29556256:29558723:-1 gene:ENSMMUG00000010291 transcript:ENSMMUT00000014383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSQPGACPCQGAASRPAILYALLSSSLRAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGGSGQPPDRPQPSLAAVQWLQCCLESFWGLELSPKEYACLKGTILFNPDVP
GLQAASHIGHLQQEAHWALCEVLEPWCPAAQGRLARVLLTASTLKSIPTSLLGDLFFRPI
IGDVDIAGLLGDMLLLR
Download sequence
Identical sequences A0A096N961 F6T9I1 G8F2G6
9544.ENSMMUP00000013473 ENSPANP00000009164 ENSMMUP00000013473 ENSMMUP00000013473 XP_001110533.1.72884 XP_005544361.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]