SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013515 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013515
Domain Number 1 Region: 5-172
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.05e-42
Family Regulator of chromosome condensation RCC1 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013515   Gene: ENSMMUG00000030237   Transcript: ENSMMUT00000014427
Sequence length 183
Comment pep:known chromosome:MMUL_1:5:81351111:81364471:1 gene:ENSMMUG00000030237 transcript:ENSMMUT00000014427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLNGIKIIQVSCGHYHSLALSKDSQVFSWGKNSHGQLGLGKEVPSQASPQRVRSLEGIPL
AQVAAGGAHSFALSLCGTSFGWGSNSAGQLALSGRNVPVKTVVPKLVTHSNNLGSCITCV
SQSAPILTLDGKVFTFGDNSSGQLGYSPTPEKRGPQLVERIDGLVSQIDCGRKSRKHGFM
TFF
Download sequence
Identical sequences ENSMMUP00000013515 9544.ENSMMUP00000013515 ENSMMUP00000013515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]