SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013516 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013516
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.14e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 503-579
Classification Level Classification E-value
Superfamily Moesin tail domain 7.06e-20
Family Moesin tail domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013516   Gene: ENSMMUG00000010311   Transcript: ENSMMUT00000014428
Sequence length 615
Comment pep:known chromosome:MMUL_1:10:73432600:73524605:1 gene:ENSMMUG00000010311 transcript:ENSMMUT00000014428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKTPPRQKTYLHLSPQSRLFPGI
LSVVMALPSVILTRA
Download sequence
Identical sequences ENSMMUP00000013509 9544.ENSMMUP00000013509 ENSMMUP00000013516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]