SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013676 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013676
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.6e-19
Family PB1 domain 0.00000766
Further Details:      
 
Domain Number 2 Region: 209-264
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000671
Family ZZ domain 0.0091
Further Details:      
 
Domain Number 3 Region: 917-954
Classification Level Classification E-value
Superfamily UBA-like 0.00000000185
Family UBA domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013676   Gene: ENSMMUG00000010433   Transcript: ENSMMUT00000014598
Sequence length 965
Comment pep:known chromosome:MMUL_1:16:53278414:53318379:1 gene:ENSMMUG00000010433 transcript:ENSMMUT00000014598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVNRAR
WREYEEALKMAVKQGNQLQMQVHEGHHVVDEALPPVVGAKRLAARAGKKPLAHYSSLVRV
LGSDMKKTPEDPAVQSLPLAPCDTDQPQDKPPDWFTSYLETFREQVVKETVEKLEQKLHE
KLVLQNPSLGSYPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNI
CEDCEAGPYSHDTNHVLLKLRRPVVGSSEPFSHSKYSTPRLPAALEQVRLQKQVDKNFLK
AEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLML
PLQPYTPVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNL
TLASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVD
PFPSEESPDNIEKGMISSSKTDDLTCQQEEAFLLAKEERQLGEVTEQTEGSAACIPQKAK
NVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPHDSPLI
EKPGLGQIEEESEGTGFKALPDSTVSVKRKTQNIASVEEAEEDLSGTQFVCETVIRSLTL
DAAPDHNPPCRQKTLQMKFALPEEGPLGDEREEIVHITEEEAVMEEEEEEEEEEELKDEV
QSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGVEAGQEPAEAGE
RLPGGENQPQEHSISDILTSSQTLETVPLIPEVVELPPPLPRSPPCVHHHGSPGVDLPVT
VSEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALF
AGPPVTAQPIVSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQINNNDW
YSERY
Download sequence
Identical sequences 9544.ENSMMUP00000013677 ENSMMUP00000013676 ENSMMUP00000013677 ENSMMUP00000034380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]